Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DDB0188019
         (94 letters)

Database: /home/dicty1/resource/WorkingDBs//nr-clean
           2,329,665 sequences; 788,375,511 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|48824699|ref|ZP_00286043.1| COG0489: ATPases involved in chro...    40  0.013

>gi|48824699|ref|ZP_00286043.1| COG0489: ATPases involved in
           chromosome partitioning [Enterococcus faecium]
          Length = 232

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 14  PVIYKTIRLDNSLTVQEAILAIGQAINV---TPASDLGLYLPDDPKHLTDTELLSS 66
           PV+YKT +L+N+  +  A+ ++G  ++V   TP  +L + LP  PK    +ELLSS
Sbjct: 90  PVVYKTFQLNNASGLSTALSSLGSVVDVIQRTPVENLSI-LPSGPKPPNPSELLSS 144


  Database: /home/dicty1/resource/WorkingDBs//nr-clean
    Posted date:  Mar 10, 2005 12:10 PM
  Number of letters in database: 788,375,511
  Number of sequences in database:  2,329,665
  
Lambda     K      H
   0.321    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 115,799,011
Number of Sequences: 2329665
Number of extensions: 3670360
Number of successful extensions: 9532
Number of sequences better than  1.0: 1
Number of HSP's better than  1.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 9532
Number of HSP's gapped (non-prelim): 1
length of query: 94
length of database: 788,375,511
effective HSP length: 70
effective length of query: 24
effective length of database: 625,298,961
effective search space: 15007175064
effective search space used: 15007175064
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 76 (33.9 bits)
BLASTP 2.2.1 [Jul-12-2001]